PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G40230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 239aa    MW: 26138.7 Da    PI: 10.3146
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G40230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-151257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W +eEd ll ++v+++G  +W+ I+  ++ gR++k+c++rw + 
  LPERR01G40230.1 12 KGSWREEEDGLLRRLVAEHGAQRWSVISGGIP-GRSGKSCRLRWCNQ 57
                     799*****************************.***********985 PP

2Myb_DNA-binding569.2e-1866108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T++E+  l+ a++++G++ W+tIar ++ gRt++++k++w++ 
  LPERR01G40230.1  66 PFTAQEEAVLAAAHARHGNK-WATIARLLP-GRTDNSVKNHWNSN 108
                      89******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.986762IPR017930Myb domain
SuperFamilySSF466897.7E-2711105IPR009057Homeodomain-like
SMARTSM007172.6E-131160IPR001005SANT/Myb domain
PfamPF002493.9E-151257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-221364IPR009057Homeodomain-like
CDDcd001676.76E-121456No hitNo description
SMARTSM007174.6E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129418.66264113IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2265113IPR009057Homeodomain-like
CDDcd001674.86E-1166109No hitNo description
PfamPF002496.0E-1566108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGVSRGRASE KKGSWREEED GLLRRLVAEH GAQRWSVISG GIPGRSGKSC RLRWCNQLSP  60
GVEHRPFTAQ EEAVLAAAHA RHGNKWATIA RLLPGRTDNS VKNHWNSNLR KTLRRQAKAK  120
AKAAASLQEQ STAATCNKSP PPPLQLRRPS SDPTNYIVLD DDAPPPDPEP SLTLSLSLSL  180
PLPAGAAAAH HQDVDDENKM LGLLVMRQLV REEVQRHTPQ LAYSLMAMAA CCRPPNAPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-33121134105C-Myb DNA-Binding Domain
1mse_C6e-33121134105C-Myb DNA-Binding Domain
1gv2_A7e-33121134105MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-321211358159MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-321211358159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646750.17e-65PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D9VAZ61e-175A0A0D9VAZ6_9ORYZ; Uncharacterized protein
STRINGSi022959m2e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135442731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-41myb domain protein 77